PDB entry 1e5c

View 1e5c on RCSB PDB site
Description: Internal xylan binding domain from C. fimi Xyn10A, R262G mutant
Class: hydrolase
Keywords: hydrolase, xylan binding domain, xylanase, beta-sheet
Deposited on 2000-07-24, released 2001-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase d
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54865 (0-86)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d1e5ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e5cA (A:)
    tgcsvtatraeewsdgfnvtysvsgssawtvnlalngsqtiqaswnanvtgsgstrtvtp
    ngsgntfgvtvmkngssttpaatcags