Lineage for d1e50d_ (1e50 D:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232071Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily)
    barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices
  4. 232072Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family) (S)
  5. 232073Family b.54.1.1: Core binding factor beta, CBF [50724] (1 protein)
  6. 232074Protein Core binding factor beta, CBF [50725] (2 species)
  7. 232075Species Human (Homo sapiens) [TaxId:9606] [50726] (3 PDB entries)
  8. 232079Domain d1e50d_: 1e50 D: [59247]
    Other proteins in same PDB: d1e50a_, d1e50c_, d1e50e_, d1e50g_, d1e50q_, d1e50r_

Details for d1e50d_

PDB Entry: 1e50 (more details), 2.6 Å

PDB Description: aml1/cbfbeta complex

SCOP Domain Sequences for d1e50d_:

Sequence, based on SEQRES records: (download)

>d1e50d_ b.54.1.1 (D:) Core binding factor beta, CBF {Human (Homo sapiens)}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlqrldg
mgclefdeeraqqe

Sequence, based on observed residues (ATOM records): (download)

>d1e50d_ b.54.1.1 (D:) Core binding factor beta, CBF {Human (Homo sapiens)}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
tnlslqffptpsreyvdlereagkvylkapmilngvcviwkgwidlqrldgmgclefdee
raqqe

SCOP Domain Coordinates for d1e50d_:

Click to download the PDB-style file with coordinates for d1e50d_.
(The format of our PDB-style files is described here.)

Timeline for d1e50d_: