Lineage for d1e50c_ (1e50 C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1525684Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1526006Family b.2.5.6: RUNT domain [81318] (2 proteins)
    automatically mapped to Pfam PF00853
  6. 1526007Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 1526008Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries)
  8. 1526014Domain d1e50c_: 1e50 C: [59246]
    Other proteins in same PDB: d1e50b_, d1e50d_, d1e50f_, d1e50h_

Details for d1e50c_

PDB Entry: 1e50 (more details), 2.6 Å

PDB Description: aml1/cbfbeta complex
PDB Compounds: (C:) core-binding factor alpha subunit

SCOPe Domain Sequences for d1e50c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e50c_ b.2.5.6 (C:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens) [TaxId: 9606]}
vladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndeny
saelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp
reprr

SCOPe Domain Coordinates for d1e50c_:

Click to download the PDB-style file with coordinates for d1e50c_.
(The format of our PDB-style files is described here.)

Timeline for d1e50c_: