Lineage for d1e50c_ (1e50 C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55312Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 55415Superfamily b.2.5: p53-like transcription factors [49417] (1 family) (S)
  5. 55416Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)
  6. 55417Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
  7. 55418Species Human (Homo sapiens) [TaxId:9606] [49440] (4 PDB entries)
  8. 55422Domain d1e50c_: 1e50 C: [59246]
    Other proteins in same PDB: d1e50b_, d1e50d_, d1e50f_, d1e50h_

Details for d1e50c_

PDB Entry: 1e50 (more details), 2.6 Å

PDB Description: aml1/cbfbeta complex

SCOP Domain Sequences for d1e50c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e50c_ b.2.5.1 (C:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens)}
vladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndeny
saelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp
reprr

SCOP Domain Coordinates for d1e50c_:

Click to download the PDB-style file with coordinates for d1e50c_.
(The format of our PDB-style files is described here.)

Timeline for d1e50c_: