Lineage for d1e50b_ (1e50 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803033Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily)
    barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices
  4. 2803034Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family) (S)
    automatically mapped to Pfam PF02312
  5. 2803035Family b.54.1.1: Core binding factor beta, CBF [50724] (2 proteins)
  6. 2803036Protein Core binding factor beta, CBF [50725] (2 species)
  7. 2803037Species Human (Homo sapiens) [TaxId:9606] [50726] (3 PDB entries)
  8. 2803038Domain d1e50b_: 1e50 B: [59245]
    Other proteins in same PDB: d1e50a_, d1e50c_, d1e50e_, d1e50g_, d1e50q_, d1e50r_

Details for d1e50b_

PDB Entry: 1e50 (more details), 2.6 Å

PDB Description: aml1/cbfbeta complex
PDB Compounds: (B:) core-binding factor cbf-beta

SCOPe Domain Sequences for d1e50b_:

Sequence, based on SEQRES records: (download)

>d1e50b_ b.54.1.1 (B:) Core binding factor beta, CBF {Human (Homo sapiens) [TaxId: 9606]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlqrldg
mgclefdeeraqqe

Sequence, based on observed residues (ATOM records): (download)

>d1e50b_ b.54.1.1 (B:) Core binding factor beta, CBF {Human (Homo sapiens) [TaxId: 9606]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
tnlslqffpaswrqtpsreyvdlereagkvylkapmilngvcviwkgwidlqrldgmgcl
efdeeraqqe

SCOPe Domain Coordinates for d1e50b_:

Click to download the PDB-style file with coordinates for d1e50b_.
(The format of our PDB-style files is described here.)

Timeline for d1e50b_: