| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.6: RUNT domain [81318] (2 proteins) automatically mapped to Pfam PF00853 |
| Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species) synonym: core binding factor alpha, cbfa |
| Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries) |
| Domain d1e50r_: 1e50 R: [59253] Other proteins in same PDB: d1e50b_, d1e50d_, d1e50f_, d1e50h_ |
PDB Entry: 1e50 (more details), 2.6 Å
SCOPe Domain Sequences for d1e50r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e50r_ b.2.5.6 (R:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens) [TaxId: 9606]}
lvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrnat
aamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvd
Timeline for d1e50r_: