PDB entry 1e50

View 1e50 on RCSB PDB site
Description: aml1/cbf complex
Class: transcription
Keywords: transcription factor, transcription
Deposited on 2000-07-13, released 2001-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.268
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: core-binding factor alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: AML1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e50a_
  • Chain 'B':
    Compound: core-binding factor cbf-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: CBFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e50b_
  • Chain 'C':
    Compound: core-binding factor alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: AML1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e50c_
  • Chain 'D':
    Compound: core-binding factor cbf-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: CBFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e50d_
  • Chain 'E':
    Compound: core-binding factor alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: AML1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e50e_
  • Chain 'F':
    Compound: core-binding factor cbf-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: CBFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e50f_
  • Chain 'G':
    Compound: core-binding factor alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: AML1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e50g_
  • Chain 'H':
    Compound: core-binding factor cbf-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: CBFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e50h_
  • Chain 'Q':
    Compound: core-binding factor alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: AML1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e50q_
  • Chain 'R':
    Compound: core-binding factor alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: AML1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e50r_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e50A (A:)
    smvevladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagn
    denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
    vdgpreprrhrqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e50A (A:)
    pgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelr
    nataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e50B (B:)
    prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
    tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlqrldg
    mgclefdeeraqqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e50B (B:)
    prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
    tnlslqffpaswrqtpsreyvdlereagkvylkapmilngvcviwkgwidlqrldgmgcl
    efdeeraqqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e50C (C:)
    smvevladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagn
    denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
    vdgpreprrhrqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e50C (C:)
    vladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndeny
    saelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp
    reprr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e50D (D:)
    prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
    tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlqrldg
    mgclefdeeraqqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e50D (D:)
    prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
    tnlslqffptpsreyvdlereagkvylkapmilngvcviwkgwidlqrldgmgclefdee
    raqqe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1e50E (E:)
    smvevladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagn
    denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
    vdgpreprrhrqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e50E (E:)
    dhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysae
    lrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpre
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1e50F (F:)
    prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
    tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlqrldg
    mgclefdeeraqqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e50F (F:)
    prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
    tnlslqffptpsreyvdlereagkvylkapmilngvcviwkgwidlqrldgmgclefdee
    raqqe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1e50G (G:)
    smvevladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagn
    denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
    vdgpreprrhrqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e50G (G:)
    dhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysae
    lrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpre
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1e50H (H:)
    prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
    tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlqrldg
    mgclefdeeraqqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e50H (H:)
    prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
    tnlslqffpaswrqtpsreyvdlereagkvylkapmilngvcviwkgwidlqrldgmgcl
    efdeeraqqe
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1e50Q (Q:)
    smvevladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagn
    denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
    vdgpreprrhrqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e50Q (Q:)
    lvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrnat
    aamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvd
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1e50R (R:)
    smvevladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagn
    denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
    vdgpreprrhrqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e50R (R:)
    lvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrnat
    aamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvd