| Class g: Small proteins [56992] (92 folds) | 
| Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse  | 
Superfamily g.44.1: RING/U-box [57850] (7 families) ![]()  | 
| Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) | 
| Protein Not-4 N-terminal RING finger domain [64579] (1 species) | 
| Species Human (Homo sapiens) [TaxId:9606] [64580] (2 PDB entries) | 
| Domain d1e4ua_: 1e4u A: [59231] complexed with zn  | 
PDB Entry: 1e4u (more details)
SCOPe Domain Sequences for d1e4ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4ua_ g.44.1.1 (A:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}
msrspdakedpvecplcmepleiddinffpctcgyqicrfcwhrirtdenglcpacrkpy
pedpavykplsqeelqri
Timeline for d1e4ua_: