Lineage for d1e4ua_ (1e4u A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90744Fold g.44: RING finger domain, C3HC4 [57849] (1 superfamily)
  4. 90745Superfamily g.44.1: RING finger domain, C3HC4 [57850] (1 family) (S)
  5. 90746Family g.44.1.1: RING finger domain, C3HC4 [57851] (6 proteins)
  6. 90756Protein Not-4 N-terminal RING finger domain [64579] (1 species)
  7. 90757Species Human (Homo sapiens) [TaxId:9606] [64580] (1 PDB entry)
  8. 90758Domain d1e4ua_: 1e4u A: [59231]

Details for d1e4ua_

PDB Entry: 1e4u (more details)

PDB Description: n-terminal ring finger domain of human not-4

SCOP Domain Sequences for d1e4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ua_ g.44.1.1 (A:) Not-4 N-terminal RING finger domain {Human (Homo sapiens)}
msrspdakedpvecplcmepleiddinffpctcgyqicrfcwhrirtdenglcpacrkpy
pedpavykplsqeelqri

SCOP Domain Coordinates for d1e4ua_:

Click to download the PDB-style file with coordinates for d1e4ua_.
(The format of our PDB-style files is described here.)

Timeline for d1e4ua_: