PDB entry 1e4u

View 1e4u on RCSB PDB site
Description: n-terminal ring finger domain of human not-4
Class: gene regulation
Keywords: gene regulation, transcriptional control
Deposited on 2000-07-12, released 2001-03-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional repressor not4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1e4ua_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4uA (A:)
    msrspdakedpvecplcmepleiddinffpctcgyqicrfcwhrirtdenglcpacrkpy
    pedpavykplsqeelqri