Lineage for d1e3za1 (1e3z A:394-483)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2076979Protein Bacterial alpha-Amylase [51013] (9 species)
  7. 2076982Species Bacillus licheniformis [TaxId:1402] [51014] (8 PDB entries)
  8. 2076985Domain d1e3za1: 1e3z A:394-483 [59213]
    Other proteins in same PDB: d1e3za2
    complexed with aci, ca, na

Details for d1e3za1

PDB Entry: 1e3z (more details), 1.93 Å

PDB Description: acarbose complex of chimaeric amylase from b. amyloliquefaciens and b. licheniformis at 1.93a
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1e3za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3za1 b.71.1.1 (A:394-483) Bacterial alpha-Amylase {Bacillus licheniformis [TaxId: 1402]}
yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit
gnrsepvvinsegwgefhvnggsvsiyvqr

SCOPe Domain Coordinates for d1e3za1:

Click to download the PDB-style file with coordinates for d1e3za1.
(The format of our PDB-style files is described here.)

Timeline for d1e3za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3za2