SCOPe 2.07: Domain d1e3za1: 1e3z A:394-483

Lineage for d1e3za1 (1e3z A:394-483)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Bacillus licheniformis [TaxId:1402] [51014] (13 PDB entries)

8. Domain d1e3za1: 1e3z A:394-483 [59213]
   Other proteins in same PDB: d1e3za2
   complexed with aci, ca, na

Details for d1e3za1

PDB Entry: 1e3z, 1.93 Å

PDB Description: acarbose complex of chimaeric amylase from b. amyloliquefaciens and b. licheniformis at 1.93a

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1e3za1:

Sequence; same for both SEQRES and ATOM records:

>d1e3za1 b.71.1.1 (A:394-483) Bacterial alpha-Amylase {Bacillus licheniformis [TaxId: 1402]}
yaygaqhdyfdhhdivgwtregdssvansglaalitdgpggakrmyvgrqnagetwhdit
gnrsepvvinsegwgefhvnggsvsiyvqr

Timeline for d1e3za1:

• d1e3za1 first appeared in SCOP 1.57
  
• d1e3za1 appears in SCOPe 2.06
  
• d1e3za1 appears in the current release, SCOPe 2.08