Class a: All alpha proteins [46456] (290 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein Progesterone receptor [48517] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48518] (10 PDB entries) Uniprot P06401 679-932 |
Domain d1e3kb_: 1e3k B: [59194] complexed with r18 |
PDB Entry: 1e3k (more details), 2.8 Å
SCOPe Domain Sequences for d1e3kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3kb_ a.123.1.1 (B:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila gmvkpllfh
Timeline for d1e3kb_: