PDB entry 1e3k

View 1e3k on RCSB PDB site
Description: human progesteron receptor ligand binding domain in complex with the ligand metribolone (r1881)
Class: human progesterone receptor
Keywords: human progesterone receptor, ligand binding domain
Deposited on 2000-06-19, released 2001-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3ka_
  • Chain 'B':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3kb_
  • Heterogens: R18, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3kA (A:)
    spgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwsks
    lpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfy
    slcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelika
    iglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaa
    qlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3kA (A:)
    qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
    lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
    wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
    gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
    agmvkpllfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e3kB (B:)
    spgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwsks
    lpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfy
    slcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelika
    iglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaa
    qlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3kB (B:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfh