Lineage for d1duwa_ (1duw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734167Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2734246Protein Nine-heme cytochrome c [48705] (2 species)
    tandem repeat of two cytochrome c3-like domains with additional heme-binding site in the domain interface
  7. 2734254Species Desulfovibrio desulfuricans, ATCC 29577 [TaxId:876] [63634] (1 PDB entry)
  8. 2734255Domain d1duwa_: 1duw A: [59138]
    complexed with gol, hec
    multiple common domains: applies to families that are inconsistently divided into domains

Details for d1duwa_

PDB Entry: 1duw (more details), 1.89 Å

PDB Description: structure of nonaheme cytochrome c
PDB Compounds: (A:) nonaheme cytochrome c

SCOPe Domain Sequences for d1duwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duwa_ a.138.1.1 (A:) Nine-heme cytochrome c {Desulfovibrio desulfuricans, ATCC 29577 [TaxId: 876]}
eptdsgapsaivmfpvsakpnpkgaamkpavfnhlahekkiancetchhtgdpvacstch
ttegkaegnfvtldramhatniakrakgntpvscvscheqqtkerrecagchaivtpkrd
qawcatchnvtssmtpeqmqqgikgklppdqnealaaetvlnhkpvqpltamqgpykvsi
daladkyepsnfthrrhmaslmerikgdklaeafhnkpetlcatchhrsplsatppkcgs
chtkeidpanpnrpnlkaayhlqcmgchqgmnvgrpkntdcttchkarp

SCOPe Domain Coordinates for d1duwa_:

Click to download the PDB-style file with coordinates for d1duwa_.
(The format of our PDB-style files is described here.)

Timeline for d1duwa_: