PDB entry 1duw

View 1duw on RCSB PDB site
Description: structure of nonaheme cytochrome c
Class: electron transport
Keywords: heme, electron transport, cytochrome c, hydrogenase, hmc operon
Deposited on 2000-01-19, released 2001-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nonaheme cytochrome c
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1duwa_
  • Heterogens: HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1duwA (A:)
    aaleptdsgapsaivmfpvsakpnpkgaamkpavfnhlahekkiancetchhtgdpvacs
    tchttegkaegnfvtldramhatniakrakgntpvscvscheqqtkerrecagchaivtp
    krdqawcatchnvtssmtpeqmqqgikgklppdqnealaaetvlnhkpvqpltamqgpyk
    vsidaladkyepsnfthrrhmaslmerikgdklaeafhnkpetlcatchhrsplsatppk
    cgschtkeidpanpnrpnlkaayhlqcmgchqgmnvgrpkntdcttchkarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1duwA (A:)
    eptdsgapsaivmfpvsakpnpkgaamkpavfnhlahekkiancetchhtgdpvacstch
    ttegkaegnfvtldramhatniakrakgntpvscvscheqqtkerrecagchaivtpkrd
    qawcatchnvtssmtpeqmqqgikgklppdqnealaaetvlnhkpvqpltamqgpykvsi
    daladkyepsnfthrrhmaslmerikgdklaeafhnkpetlcatchhrsplsatppkcgs
    chtkeidpanpnrpnlkaayhlqcmgchqgmnvgrpkntdcttchkarp