Lineage for d1d4xa1 (1d4x A:4-146)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124261Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 124262Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)
  6. 124263Protein Actin [53073] (5 species)
  7. 124274Species Nematode (Caenorhabditis elegans) [TaxId:6239] [64086] (1 PDB entry)
  8. 124275Domain d1d4xa1: 1d4x A:4-146 [59107]
    Other proteins in same PDB: d1d4xg_

Details for d1d4xa1

PDB Entry: 1d4x (more details), 1.75 Å

PDB Description: crystal structure of caenorhabditis elegans mg-atp actin complexed with human gelsolin segment 1 at 1.75 a resolution.

SCOP Domain Sequences for d1d4xa1:

Sequence, based on SEQRES records: (download)

>d1d4xa1 c.55.1.1 (A:4-146) Actin {Nematode (Caenorhabditis elegans)}
evaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1d4xa1 c.55.1.1 (A:4-146) Actin {Nematode (Caenorhabditis elegans)}
evaalvvdngsgmckagfagddapravfpsivgrprhqgvgqkdsyvgdeaqskrgiltl
kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
ntpamyvaiqavlslyasg

SCOP Domain Coordinates for d1d4xa1:

Click to download the PDB-style file with coordinates for d1d4xa1.
(The format of our PDB-style files is described here.)

Timeline for d1d4xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d4xa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1d4xg_