Lineage for d3phma2 (3phm A:199-354)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2430786Superfamily b.121.1: PHM/PNGase F [49742] (2 families) (S)
    members of this superfamily bind peptide substrates
    duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits
  5. 2430800Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein)
  6. 2430801Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species)
  7. 2430802Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (26 PDB entries)
  8. 2430818Domain d3phma2: 3phm A:199-354 [59061]
    complexed with azi, cu, gol, ni

Details for d3phma2

PDB Entry: 3phm (more details), 2.1 Å

PDB Description: reduced (cu+) peptidylglycine alpha-hydroxylating monooxygenase (phm)
PDB Compounds: (A:) protein (peptidylglycine alpha-hydroxylating monooxygenase)

SCOPe Domain Sequences for d3phma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phma2 b.121.1.2 (A:199-354) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng
qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgegrteathiggtssdemcnly
imyymeakyalsfmtctknvapdmfrtipaeanipi

SCOPe Domain Coordinates for d3phma2:

Click to download the PDB-style file with coordinates for d3phma2.
(The format of our PDB-style files is described here.)

Timeline for d3phma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3phma1