Lineage for d3phma2 (3phm A:199-354)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.13: PNGase F-like [49741] (2 superfamilies) 
Superfamily b.13.1: PHM/PNGase F [49742] (2 families) 
Family b.13.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein) Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [49748] (3 PDB entries) 
Domain d3phma2: 3phm A:199-354 [59061]
Details for d3phma2
PDB Entry: 3phm (more details), 2.1 Å
PDB Description: reduced (cu+) peptidylglycine alpha-hydroxylating monooxygenase (phm)
SCOP Domain Sequences for d3phma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3phma2 b.13.1.2 (A:199-354) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Rat (Rattus norvegicus)}
pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng
qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgegrteathiggtssdemcnly
imyymeakyalsfmtctknvapdmfrtipaeanipi
SCOP Domain Coordinates for d3phma2:
Click to download the PDB-style file with coordinates for d3phma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3phma2:
- d3phma2 is new in SCOP 1.57
- d3phma2 appears in SCOP 1.59
- d3phma2 appears in the current release, SCOPe 2.08
View in 3D
