SCOPe 2.06: Domain d1slma2: 1slm A:81-250

Lineage for d1slma2 (1slm A:81-250)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (40 PDB entries)

8. Domain d1slma2: 1slm A:81-250 [59043]
   Other proteins in same PDB: d1slma1
   truncated proenzyme
   complexed with ca, zn

Details for d1slma2

PDB Entry: 1slm, 1.9 Å

PDB Description: crystal structure of fibroblast stromelysin-1: the c-truncated human proenzyme

PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d1slma2:

Sequence; same for both SEQRES and ATOM records:

>d1slma2 d.92.1.11 (A:81-250) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
ghfrtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegea
dimisfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaa
heighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

Timeline for d1slma2:

• d1slma2 first appeared in SCOP 1.57, called d1slm_2
  
• d1slma2 appears in SCOPe 2.05
  
• d1slma2 appears in SCOPe 2.07
  
• d1slma2 appears in the current release, SCOPe 2.08