Lineage for d1slma2 (1slm A:81-250)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964558Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 2964559Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. 2964627Domain d1slma2: 1slm A:81-250 [59043]
    Other proteins in same PDB: d1slma1
    truncated proenzyme
    complexed with ca, zn

Details for d1slma2

PDB Entry: 1slm (more details), 1.9 Å

PDB Description: crystal structure of fibroblast stromelysin-1: the c-truncated human proenzyme
PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d1slma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slma2 d.92.1.11 (A:81-250) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
ghfrtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegea
dimisfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaa
heighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

SCOPe Domain Coordinates for d1slma2:

Click to download the PDB-style file with coordinates for d1slma2.
(The format of our PDB-style files is described here.)

Timeline for d1slma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1slma1