SCOP 1.61: Domain d1slm_2: 1slm 81-250

Lineage for d1slm_2 (1slm 81-250)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries)

8. Domain d1slm_2: 1slm 81-250 [59043]
   Other proteins in same PDB: d1slm_1

Details for d1slm_2

PDB Entry: 1slm, 1.9 Å

PDB Description: crystal structure of fibroblast stromelysin-1: the c-truncated human proenzyme

SCOP Domain Sequences for d1slm_2:

Sequence; same for both SEQRES and ATOM records:

>d1slm_2 d.92.1.11 (81-250) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
ghfrtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegea
dimisfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaa
heighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

Timeline for d1slm_2:

• d1slm_2 first appeared in SCOP 1.57
  
• d1slm_2 appears in SCOP 1.59
  
• d1slm_2 appears in SCOP 1.63
  
• d1slm_2 appears in the current release, SCOPe 2.08, called d1slma2