Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.1: 4'-Phosphopantetheinyl transferase SFP [56215] (1 protein) monomeric; tandem duplication of beta-alpha(3)-beta(2) motif |
Protein 4'-Phosphopantetheinyl transferase SFP [63407] (1 species) |
Species Bacillus subtilis [TaxId:1423] [56217] (1 PDB entry) |
Domain d1qr0a2: 1qr0 A:102-228 [59039] complexed with coa, mg |
PDB Entry: 1qr0 (more details), 1.9 Å
SCOPe Domain Sequences for d1qr0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qr0a2 d.150.1.1 (A:102-228) 4'-Phosphopantetheinyl transferase SFP {Bacillus subtilis [TaxId: 1423]} qpigidiektkpisleiakrffskteysdllakdkdeqtdyfyhlwsmkesfikqegkgl slpldsfsvrlhqdgqvsielpdshspcyiktyevdpgykmavcaahpdfpeditmvsye ellraaa
Timeline for d1qr0a2: