Lineage for d1qr0a2 (1qr0 A:102-228)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222432Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 1222433Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 1222434Family d.150.1.1: 4'-Phosphopantetheinyl transferase SFP [56215] (1 protein)
    monomeric; tandem duplication of beta-alpha(3)-beta(2) motif
  6. 1222435Protein 4'-Phosphopantetheinyl transferase SFP [63407] (1 species)
  7. 1222436Species Bacillus subtilis [TaxId:1423] [56217] (1 PDB entry)
  8. 1222438Domain d1qr0a2: 1qr0 A:102-228 [59039]
    complexed with coa, mg

Details for d1qr0a2

PDB Entry: 1qr0 (more details), 1.9 Å

PDB Description: crystal structure of the 4'-phosphopantetheinyl transferase sfp- coenzyme a complex
PDB Compounds: (A:) 4'-phosphopantetheinyl transferase sfp

SCOPe Domain Sequences for d1qr0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr0a2 d.150.1.1 (A:102-228) 4'-Phosphopantetheinyl transferase SFP {Bacillus subtilis [TaxId: 1423]}
qpigidiektkpisleiakrffskteysdllakdkdeqtdyfyhlwsmkesfikqegkgl
slpldsfsvrlhqdgqvsielpdshspcyiktyevdpgykmavcaahpdfpeditmvsye
ellraaa

SCOPe Domain Coordinates for d1qr0a2:

Click to download the PDB-style file with coordinates for d1qr0a2.
(The format of our PDB-style files is described here.)

Timeline for d1qr0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qr0a1