PDB entry 1qr0

View 1qr0 on RCSB PDB site
Description: crystal structure of the 4'-phosphopantetheinyl transferase sfp-coenzyme a complex
Class: transferase
Keywords: protein-coenzyme a complex, transferase
Deposited on 1999-06-17, released 1999-12-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4'-phosphopantetheinyl transferase sfp
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39135 (0-223)
      • conflict (224-227)
    Domains in SCOPe 2.03: d1qr0a1, d1qr0a2
  • Heterogens: MG, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qr0A (A:)
mkiygiymdrplsqeenerfmtfispekrekcrrfyhkedahrtllgdvlvrsvisrqyq
ldksdirfstqeygkpcipdlpdahfnishsgrwvigafdsqpigidiektkpisleiak
rffskteysdllakdkdeqtdyfyhlwsmkesfikqegkglslpldsfsvrlhqdgqvsi
elpdshspcyiktyevdpgykmavcaahpdfpeditmvsyeellraaa