SCOP 1.63: Domain d1gg4a3: 1gg4 A:1-98

Lineage for d1gg4a3 (1gg4 A:1-98)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core.

4. Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (1 family)
   binds UDP group

5. Family c.98.1.1: MurE/MurF N-terminal domain [63419] (2 proteins)

6. Protein UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF [63420] (1 species)

7. Species Escherichia coli [TaxId:562] [63421] (1 PDB entry)

8. Domain d1gg4a3: 1gg4 A:1-98 [58985]
   Other proteins in same PDB: d1gg4a1, d1gg4a4, d1gg4b1, d1gg4b4

Details for d1gg4a3

PDB Entry: 1gg4, 2.3 Å

PDB Description: crystal structure of escherichia coli udpmurnac-tripeptide d-alanyl-d- alanine-adding enzyme (murf) at 2.3 angstrom resolution

SCOP Domain Sequences for d1gg4a3:

Sequence; same for both SEQRES and ATOM records:

>d1gg4a3 c.98.1.1 (A:1-98) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli}
misvtlsqltdilngelqgaditldavttdtrkltpgclfvalkgerfdahdfadqakag
gagallvsrpldidlpqlivkdtrlafgelaawvrqqv

Timeline for d1gg4a3:

• d1gg4a3 first appeared in SCOP 1.57
  
• d1gg4a3 appears in SCOP 1.61
  
• d1gg4a3 appears in SCOP 1.65
  
• d1gg4a3 appears in the current release, SCOPe 2.08