SCOP 1.63: Domain d1gg4b1: 1gg4 B:813-947

Lineage for d1gg4b1 (1gg4 B:813-947)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families)

5. Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)

6. Protein UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF [53248] (1 species)

7. Species Escherichia coli [TaxId:562] [53249] (1 PDB entry)

8. Domain d1gg4b1: 1gg4 B:813-947 [33958]
   Other proteins in same PDB: d1gg4a3, d1gg4a4, d1gg4b3, d1gg4b4

Details for d1gg4b1

PDB Entry: 1gg4, 2.3 Å

PDB Description: crystal structure of escherichia coli udpmurnac-tripeptide d-alanyl-d- alanine-adding enzyme (murf) at 2.3 angstrom resolution

SCOP Domain Sequences for d1gg4b1:

Sequence; same for both SEQRES and ATOM records:

>d1gg4b1 c.59.1.1 (B:813-947) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli}
vpgrlfpiqlaenqlllddsynanvgsmtaavqvlaempgyrvlvvgdmaelgaeseach
vqvgeaakaagidrvlsvgkqshaistasgvgehfadktalitrlklliaeqqvitilvk
gsrsaameevvralq

Timeline for d1gg4b1:

• d1gg4b1 first appeared (with stable ids) in SCOP 1.55
  
• d1gg4b1 appears in SCOP 1.61
  
• d1gg4b1 appears in SCOP 1.65
  
• d1gg4b1 appears in the current release, SCOPe 2.08