SCOP 1.57: Domain d1be3b2: 1be3 B:236-439

Lineage for d1be3b2 (1be3 B:236-439)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)

5. Family d.185.1.1: MPP-like [63412] (4 proteins)

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56000] (3 PDB entries)

8. Domain d1be3b2: 1be3 B:236-439 [58953]
   Other proteins in same PDB: d1be3a1, d1be3a2, d1be3c1, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f1, d1be3g1, d1be3h1, d1be3j1, d1be3k1

Details for d1be3b2

PDB Entry: 1be3, 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3b2:

Sequence; same for both SEQRES and ATOM records:

>d1be3b2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

Timeline for d1be3b2:

• d1be3b2 is new in SCOP 1.57
  
• d1be3b2 appears in SCOP 1.59
  
• d1be3b2 appears in the current release, SCOPe 2.08