Lineage for d1be3f1 (1be3 F:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 87917Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 87918Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 87949Species Cow (Bos taurus) [TaxId:9913] [56908] (3 PDB entries)
  8. 87953Domain d1be3f1: 1be3 F: [43668]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3d2, d1be3e1

Details for d1be3f1

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3f1 f.2.1.8 (F:) Cytochrome bc1 transmembrane subunits {Cow (Bos taurus)}
avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr
aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOP Domain Coordinates for d1be3f1:

Click to download the PDB-style file with coordinates for d1be3f1.
(The format of our PDB-style files is described here.)

Timeline for d1be3f1: