Lineage for d1be3a2 (1be3 A:234-446)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86102Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 86103Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 86104Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 86105Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 86116Species Cow (Bos taurus) [TaxId:9913] [55997] (3 PDB entries)
  8. 86118Domain d1be3a2: 1be3 A:234-446 [58951]
    Other proteins in same PDB: d1be3b1, d1be3b2, d1be3c1, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f1, d1be3g1, d1be3h1, d1be3j1, d1be3k1

Details for d1be3a2

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3a2 d.185.1.1 (A:234-446) Cytochrome bc1 core subunit 1 {Cow (Bos taurus)}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpieqlpdynrirsgmfwlrf

SCOP Domain Coordinates for d1be3a2:

Click to download the PDB-style file with coordinates for d1be3a2.
(The format of our PDB-style files is described here.)

Timeline for d1be3a2: