Lineage for d1c94a_ (1c94 A:)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048030Fold k.11: Retro-GCN4 leucine zipper [58851] (1 superfamily)
  4. 3048031Superfamily k.11.1: Retro-GCN4 leucine zipper [58852] (1 family) (S)
  5. 3048032Family k.11.1.1: Retro-GCN4 leucine zipper [58853] (1 protein)
  6. 3048033Protein Retro-GCN4 leucine zipper [58854] (1 species)
  7. 3048034Species Synthetic [58855] (1 PDB entry)
  8. 3048035Domain d1c94a_: 1c94 A: [46428]
    CASP3

Details for d1c94a_

PDB Entry: 1c94 (more details), 2.08 Å

PDB Description: reversing the sequence of the gcn4 leucine zipper does not affect its fold.
PDB Compounds: (A:) retro-gcn4 leucine zipper

SCOPe Domain Sequences for d1c94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c94a_ k.11.1.1 (A:) Retro-GCN4 leucine zipper {Synthetic}
ggregvlkklravenelhynkslleevkdelqkmrql

SCOPe Domain Coordinates for d1c94a_:

Click to download the PDB-style file with coordinates for d1c94a_.
(The format of our PDB-style files is described here.)

Timeline for d1c94a_:

3048035
d1c94a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1c94b_