PDB entry 1c94

View 1c94 on RCSB PDB site
Description: reversing the sequence of the gcn4 leucine zipper does not affect its fold.
Class: gene regulation
Keywords: retro-coiled coil, 4-alpha-helix-bundle, peptide synthesis, gene regulation
Deposited on 1999-07-30, released 2000-03-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retro-gcn4 leucine zipper
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1C94 (Start-37)
    Domains in SCOPe 2.08: d1c94a_
  • Chain 'B':
    Compound: retro-gcn4 leucine zipper
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1C94 (Start-37)
    Domains in SCOPe 2.08: d1c94b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1c94A (A:)
cggregvlkklravenelhynkslleevkdelqkmrql

    Sequence, based on observed residues (ATOM records): (download) 
    >1c94A (A:)
ggregvlkklravenelhynkslleevkdelqkmrql

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1c94B (B:)
cggregvlkklravenelhynkslleevkdelqkmrql

    Sequence, based on observed residues (ATOM records): (download) 
    >1c94B (B:)
ggregvlkklravenelhynkslleevkdelqkmrql