Lineage for d1g8xa1 (1g8x A:2-1002)

  1. Root: SCOPe 2.07
  2. 2598153Class k: Designed proteins [58788] (44 folds)
  3. 2598154Fold k.1: Hybrid and chimeric proteins [58789] (1 superfamily)
  4. 2598155Superfamily k.1.1: Hybrid and chimeric proteins [58790] (1 family) (S)
  5. 2598156Family k.1.1.1: Hybrid and chimeric proteins [58791] (3 proteins)
  6. 2598157Protein Genetically engineered molecular motor [58796] (1 species)
    myosin II heavy chain fused to alpha-actinin spectrin-like repeats 1 and 2
  7. 2598158Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [58797] (1 PDB entry)
  8. 2598159Domain d1g8xa1: 1g8x A:2-1002 [46378]
    Other proteins in same PDB: d1g8xa2, d1g8xb2
    complexed with adp, mg

Details for d1g8xa1

PDB Entry: 1g8x (more details), 2.8 Å

PDB Description: structure of a genetically engineered molecular motor
PDB Compounds: (A:) myosin II heavy chain fused to alpha-actinin 3

SCOPe Domain Sequences for d1g8xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8xa1 k.1.1.1 (A:2-1002) Genetically engineered molecular motor {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpderdsyecgeivsetsdsft
fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
gagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssefgk
fieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagp
esfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfek
gagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdal
vkalygrlflwlvkkinnvlcserkayfigvldisgfeifkvnsfeqlcinytneklqqf
fnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdn
tlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfk
dssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnk
qlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqk
atdavlkhlnidpeqyrfgitkiffragqlarieeareqrlgseqtksdylkranelvqw
indkqaslesrdfgdsiesvqsfmnahkeykktekppkgqevseleaiynslqtklrlik
repfvapagltpneidstwsalekaeqehaealrielkrqkkiavllqkynrilkklenw
attksvylgsnetgdsitavqaklknleafdgecqslegqsnsdllsilaqltelnyngv
pelterkdtffaqqwtgvkssaetykntllaelerlqkied

SCOPe Domain Coordinates for d1g8xa1:

Click to download the PDB-style file with coordinates for d1g8xa1.
(The format of our PDB-style files is described here.)

Timeline for d1g8xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g8xa2