PDB entry 1g8x

View 1g8x on RCSB PDB site
Description: structure of a genetically engineered molecular motor
Class: structural protein
Keywords: myosin, motor, alpha-actinin, dictyostelium, lever arm, protein engineering, structural protein
Deposited on 2000-11-21, released 2001-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin II heavy chain fused to alpha-actinin 3
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (Start-760)
      • engineered (237)
      • engineered (311)
      • engineered (320)
      • engineered (442)
      • engineered (488)
    • Uniprot P05095 (764-1001)
    Domains in SCOPe 2.07: d1g8xa1, d1g8xa2
  • Chain 'B':
    Compound: myosin II heavy chain fused to alpha-actinin 3
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (Start-760)
      • engineered (237)
      • engineered (311)
      • engineered (320)
      • engineered (442)
      • engineered (488)
    • Uniprot P05095 (764-1001)
    Domains in SCOPe 2.07: d1g8xb1, d1g8xb2
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g8xA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpderdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssefg
    kfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcserkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieeareqrlgseqtksdylkranelvq
    windkqaslesrdfgdsiesvqsfmnahkeykktekppkgqevseleaiynslqtklrli
    krepfvapagltpneidstwsalekaeqehaealrielkrqkkiavllqkynrilkklen
    wattksvylgsnetgdsitavqaklknleafdgecqslegqsnsdllsilaqltelnyng
    vpelterkdtffaqqwtgvkssaetykntllaelerlqkiedlhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8xA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpderdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssefgk
    fieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagp
    esfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfek
    gagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdal
    vkalygrlflwlvkkinnvlcserkayfigvldisgfeifkvnsfeqlcinytneklqqf
    fnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdn
    tlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfk
    dssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnk
    qlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqk
    atdavlkhlnidpeqyrfgitkiffragqlarieeareqrlgseqtksdylkranelvqw
    indkqaslesrdfgdsiesvqsfmnahkeykktekppkgqevseleaiynslqtklrlik
    repfvapagltpneidstwsalekaeqehaealrielkrqkkiavllqkynrilkklenw
    attksvylgsnetgdsitavqaklknleafdgecqslegqsnsdllsilaqltelnyngv
    pelterkdtffaqqwtgvkssaetykntllaelerlqkiedlhhhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g8xB (B:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpderdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssefg
    kfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcserkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieeareqrlgseqtksdylkranelvq
    windkqaslesrdfgdsiesvqsfmnahkeykktekppkgqevseleaiynslqtklrli
    krepfvapagltpneidstwsalekaeqehaealrielkrqkkiavllqkynrilkklen
    wattksvylgsnetgdsitavqaklknleafdgecqslegqsnsdllsilaqltelnyng
    vpelterkdtffaqqwtgvkssaetykntllaelerlqkiedlhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8xB (B:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpderdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssefgk
    fieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagp
    esfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfek
    gagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdal
    vkalygrlflwlvkkinnvlcserkayfigvldisgfeifkvnsfeqlcinytneklqqf
    fnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdn
    tlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfk
    dssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnk
    qlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqk
    atdavlkhlnidpeqyrfgitkiffragqlarieeareqrlgseqtksdylkranelvqw
    indkqaslesrdfgdsiesvqsfmnahkeykktekppkgqevseleaiynslqtklrlik
    repfvapagltpneidstwsalekaeqehaealrielkrqkkiavllqkynrilkklenw
    attksvylgsnetgdsitavqaklknleafdgecqslegqsnsdllsilaqltelnyngv
    pelterkdtffaqqwtgvkssaetykntllaelerlqkiedlhhhhhhh