Lineage for d1e0ab1 (1e0a B:75-118)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046937Fold j.65: Peptide derived from p-21 activated kinase [58722] (1 superfamily)
  4. 3046938Superfamily j.65.1: Peptide derived from p-21 activated kinase [58723] (1 family) (S)
  5. 3046939Family j.65.1.1: Peptide derived from p-21 activated kinase [58724] (1 protein)
  6. 3046940Protein Peptide derived from p-21 activated kinase [58725] (2 species)
  7. 3046943Species Norway rat (Rattus norvegicus) [TaxId:10116] [58727] (1 PDB entry)
  8. 3046944Domain d1e0ab1: 1e0a B:75-118 [46357]
    Other proteins in same PDB: d1e0aa_, d1e0ab2
    bound to CDC42Hs
    complexed with gnp, mg

Details for d1e0ab1

PDB Entry: 1e0a (more details)

PDB Description: cdc42 complexed with the gtpase binding domain of p21 activated kinase
PDB Compounds: (B:) Serine/threonine-protein kinase PAK 1

SCOPe Domain Sequences for d1e0ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ab1 j.65.1.1 (B:75-118) Peptide derived from p-21 activated kinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
islpsdfehtihvgfdavtgeftgmpeqwarllqtsnitkseqk

SCOPe Domain Coordinates for d1e0ab1:

Click to download the PDB-style file with coordinates for d1e0ab1.
(The format of our PDB-style files is described here.)

Timeline for d1e0ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e0ab2
View in 3D
Domains from other chains:
(mouse over for more information)
d1e0aa_