PDB entry 1e0a

View 1e0a on RCSB PDB site
Description: Cdc42 complexed with the GTPase binding domain of p21 activated kinase
Class: signalling protein/kinase
Keywords: signalling protein, g protein signalling ser/thr kinase, signalling protein-kinase complex
Deposited on 2000-03-16, released 2000-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cell division control protein 42 homolog
  Species: Homo sapiens [TaxId:9606]
  Gene: CDC42
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60953 (0-183)
    • engineered mutation (60)
  Domains in SCOPe 2.08: d1e0aa_
• Chain 'B':
  Compound: Serine/threonine-protein kinase PAK 1
  Species: Rattus norvegicus [TaxId:10116]
  Gene: PAK1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35465 (2-45)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d1e0ab1, d1e0ab2
• Heterogens: GNP, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e0aA (A:)
  mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
  ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
  ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
  epkk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e0aB (B:)
  gsislpsdfehtihvgfdavtgeftgmpeqwarllqtsnitkseqk