Lineage for d1jsuc_ (1jsu C:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651427Fold j.55: P27(KIP1) fragment 22-106 [58672] (1 superfamily)
  4. 2651428Superfamily j.55.1: P27(KIP1) fragment 22-106 [58673] (1 family) (S)
  5. 2651429Family j.55.1.1: P27(KIP1) fragment 22-106 [58674] (1 protein)
  6. 2651430Protein P27(KIP1) fragment 22-106 [58675] (1 species)
  7. 2651431Species Human (Homo sapiens) [TaxId:9606] [58676] (1 PDB entry)
  8. 2651432Domain d1jsuc_: 1jsu C: [46339]
    Other proteins in same PDB: d1jsua_, d1jsub1, d1jsub2
    complexed with so4

Details for d1jsuc_

PDB Entry: 1jsu (more details), 2.3 Å

PDB Description: p27(kip1)/cyclin a/cdk2 complex
PDB Compounds: (C:) p27

SCOPe Domain Sequences for d1jsuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsuc_ j.55.1.1 (C:) P27(KIP1) fragment 22-106 {Human (Homo sapiens) [TaxId: 9606]}
kpsacrnlfgpvdheeltrdlekhcrdmeeasqrkwnfdfqnhkplegkyewqevekgsl
pefyyrppr

SCOPe Domain Coordinates for d1jsuc_:

Click to download the PDB-style file with coordinates for d1jsuc_.
(The format of our PDB-style files is described here.)

Timeline for d1jsuc_: