Lineage for d1jsuc_ (1jsu C:)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.55: P27(KIP1) fragment 22-106 [58672] (1 superfamily)
  4. Superfamily j.55.1: P27(KIP1) fragment 22-106 [58673] (1 family) (S)
  5. Family j.55.1.1: P27(KIP1) fragment 22-106 [58674] (1 protein)
  6. Protein P27(KIP1) fragment 22-106 [58675] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58676] (1 PDB entry)
  8. Domain d1jsuc_: 1jsu C: [46339]
    Other proteins in same PDB: d1jsua_, d1jsub1, d1jsub2

Details for d1jsuc_

PDB Entry: 1jsu (more details), 2.3 Å

PDB Description: p27(kip1)/cyclin a/cdk2 complex

SCOP Domain Sequences for d1jsuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jsuc_ j.55.1.1 (C:) P27(KIP1) fragment 22-106 {Human (Homo sapiens)}
kpsacrnlfgpvdheeltrdlekhcrdmeeasqrkwnfdfqnhkplegkyewqevekgsl
pefyyrppr

SCOP Domain Coordinates for d1jsuc_ are not available.

Timeline for d1jsuc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jsua_, d1jsub1, d1jsub2