Class j: Peptides [58231] (133 folds) |
Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily) |
Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family) |
Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein) |
Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries) |
Domain d1hpha_: 1hph A: [46159] |
PDB Entry: 1hph (more details)
SCOPe Domain Sequences for d1hpha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hpha_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]} svseiqlmhnlgkhlnsmervewlrkklqdvhnfval
Timeline for d1hpha_: