SCOPe 2.06: Domain d1hpha_: 1hph A:

Lineage for d1hpha_ (1hph A:)

1. Root: SCOPe 2.06

2. Class j: Peptides [58231] (133 folds)

3. Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)

4. Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family)

5. Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)

6. Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)

8. Domain d1hpha_: 1hph A: [46159]

Details for d1hpha_

PDB Entry: 1hph

PDB Description: structure of human parathyroid hormone 1-37 in solution

PDB Compounds: (A:) human parathyroid hormone fragment 1 - 37

SCOPe Domain Sequences for d1hpha_:

Sequence; same for both SEQRES and ATOM records:

>d1hpha_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]}
svseiqlmhnlgkhlnsmervewlrkklqdvhnfval

Timeline for d1hpha_:

• d1hpha_ first appeared (with stable ids) in SCOP 1.55, called d1hph__
  
• d1hpha_ appears in SCOPe 2.05
  
• d1hpha_ appears in SCOPe 2.07
  
• d1hpha_ appears in the current release, SCOPe 2.08