PDB entry 1hph

View 1hph on RCSB PDB site
Description: structure of human parathyroid hormone 1-37 in solution
Class: hormone
Keywords: hormone
Deposited on 1995-02-14, released 1995-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human parathyroid hormone fragment 1 - 37
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01270 (0-36)
  Domains in SCOPe 2.06: d1hpha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hphA (A:)
  svseiqlmhnlgkhlnsmervewlrkklqdvhnfval