SCOPe 2.08: Domain d1et1a_: 1et1 A:

Lineage for d1et1a_ (1et1 A:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)

4. Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family)

5. Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)

6. Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)

8. Domain d1et1a_: 1et1 A: [46152]
   complexed with na

Details for d1et1a_

PDB Entry: 1et1, 0.9 Å

PDB Description: crystal structure of human parathyroid hormone 1-34 at 0.9 a resolution

PDB Compounds: (A:) parathyroid hormone

SCOPe Domain Sequences for d1et1a_:

Sequence; same for both SEQRES and ATOM records:

>d1et1a_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]}
svseiqlmhnlgkhlnsmervewlrkklqdvhnf

Timeline for d1et1a_:

• d1et1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1et1a_ appears in SCOPe 2.07