PDB entry 1et1

View 1et1 on RCSB PDB site
Description: crystal structure of human parathyroid hormone 1-34 at 0.9 a resolution
Class: hormone/growth factor
Keywords: helical dimer, hormone-growth factor complex
Deposited on 2000-04-12, released 2000-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 0.9 Å
R-factor: N/A
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: parathyroid hormone
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01270 (0-33)
  Domains in SCOPe 2.08: d1et1a_
• Chain 'B':
  Compound: parathyroid hormone
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01270 (0-33)
  Domains in SCOPe 2.08: d1et1b_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1et1A (A:)
  svseiqlmhnlgkhlnsmervewlrkklqdvhnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1et1B (B:)
  svseiqlmhnlgkhlnsmervewlrkklqdvhnf