Lineage for d1byva_ (1byv A:)

  1. Root: SCOP 1.63
  2. 274027Class j: Peptides [58231] (101 folds)
  3. 274196Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 274197Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 274198Family j.6.1.1: Peptide hormones [58285] (13 proteins)
  6. 274199Protein Calcitonin [58301] (1 species)
  7. 274200Species Eel (Anguilla japonica) [TaxId:7937] [58302] (3 PDB entries)
  8. 274203Domain d1byva_: 1byv A: [46105]

Details for d1byva_

PDB Entry: 1byv (more details)

PDB Description: glycosylated eel calcitonin

SCOP Domain Sequences for d1byva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byva_ j.6.1.1 (A:) Calcitonin {Eel (Anguilla japonica)}
csnlstcvlgklsqelhklqtyprtdvgagtp

SCOP Domain Coordinates for d1byva_:

Click to download the PDB-style file with coordinates for d1byva_.
(The format of our PDB-style files is described here.)

Timeline for d1byva_: