Lineage for d1bzba_ (1bzb A:)
- Root: SCOP 1.61
Class j: Peptides [58231] (95 folds) 
Fold j.6: Peptide hormones [58283] (1 superfamily) Superfamily j.6.1: Peptide hormones [58284] (1 family) 
Family j.6.1.1: Peptide hormones [58285] (11 proteins) 
Protein Calcitonin [58301] (1 species) Species Eel (Anguilla japonica) [TaxId:7937] [58302] (3 PDB entries) 
Domain d1bzba_: 1bzb A: [46103]
Details for d1bzba_
PDB Entry: 1bzb (more details)
PDB Description: glycosylated eel calcitonin
SCOP Domain Sequences for d1bzba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzba_ j.6.1.1 (A:) Calcitonin {Eel (Anguilla japonica)}
csnlstcvlgklsqelhklqtyprtdvgagtp
SCOP Domain Coordinates for d1bzba_:
Click to download the PDB-style file with coordinates for d1bzba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bzba_:
- d1bzba_ first appeared (with stable ids) in SCOP 1.55
- d1bzba_ appears in SCOP 1.59
- d1bzba_ appears in SCOP 1.63
- d1bzba_ appears in the current release, SCOPe 2.08
View in 3D