Lineage for d1bzba_ (1bzb A:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3045883Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 3045884Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 3045885Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 3045886Protein Calcitonin [58301] (3 species)
  7. 3045890Species Eel (Anguilla japonica) [TaxId:7937] [58302] (3 PDB entries)
  8. 3045892Domain d1bzba_: 1bzb A: [46103]

Details for d1bzba_

PDB Entry: 1bzb (more details)

PDB Description: glycosylated eel calcitonin
PDB Compounds: (A:) protein (calcitonin)

SCOPe Domain Sequences for d1bzba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzba_ j.6.1.1 (A:) Calcitonin {Eel (Anguilla japonica) [TaxId: 7937]}
csnlstcvlgklsqelhklqtyprtdvgagtp

SCOPe Domain Coordinates for d1bzba_:

Click to download the PDB-style file with coordinates for d1bzba_.
(The format of our PDB-style files is described here.)

Timeline for d1bzba_: