PDB entry 1bzb

View 1bzb on RCSB PDB site
Description: glycosylated eel calcitonin
Class: hormone/growth factor
Keywords: hormone, calcium-regulator, osteoporosis, hormone-growth factor complex
Deposited on 1998-10-27, released 1998-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (calcitonin)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bzba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzbA (A:)
    csnlstcvlgklsqelhklqtyprtdvgagtp