SCOP 1.59: Domain d1qbfa_: 1qbf A:

Lineage for d1qbfa_ (1qbf A:)

1. Root: SCOP 1.59

2. Class j: Peptides [58231] (92 folds)

3. Fold j.6: Peptide hormones [58283] (1 superfamily)

4. Superfamily j.6.1: Peptide hormones [58284] (1 family)

5. Family j.6.1.1: Peptide hormones [58285] (10 proteins)

6. Protein Porcine peptide YY [58292] (1 species)

7. Species Synthetic [58293] (1 PDB entry)

8. Domain d1qbfa_: 1qbf A: [46092]

Details for d1qbfa_

PDB Entry: 1qbf

PDB Description: nmr solution structure of porcine peptide yy

SCOP Domain Sequences for d1qbfa_:

Sequence; same for both SEQRES and ATOM records:

>d1qbfa_ j.6.1.1 (A:) Porcine peptide YY {Synthetic}
ypakpeapgedaspeelsryyaslrhylnlvtrqry

Timeline for d1qbfa_:

• d1qbfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qbfa_ appears in SCOP 1.57
  
• d1qbfa_ appears in SCOP 1.61
  
• d1qbfa_ appears in the current release, SCOPe 2.08