PDB entry 1qbf

View 1qbf on RCSB PDB site
Description: nmr solution structure of porcine peptide yy
Deposited on 1999-04-16, released 2000-08-16
The last revision prior to the SCOP 1.59 freeze date was dated 2000-08-16, with a file datestamp of 2000-08-16.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qbfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbfA (A:)
    ypakpeapgedaspeelsryyaslrhylnlvtrqry