Lineage for d1ppt__ (1ppt -)

  1. Root: SCOP 1.61
  2. 207023Class j: Peptides [58231] (95 folds)
  3. 207155Fold j.6: Peptide hormones [58283] (1 superfamily)
  4. 207156Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
  5. 207157Family j.6.1.1: Peptide hormones [58285] (11 proteins)
  6. 207200Protein Pancreatic polypeptide [58286] (2 species)
  7. 207203Species Turkey (Meleagris gallopavo) [TaxId:9103] [58288] (1 PDB entry)
  8. 207204Domain d1ppt__: 1ppt - [46089]

Details for d1ppt__

PDB Entry: 1ppt (more details), 1.37 Å

PDB Description: x-ray analysis (1.4-angstroms resolution) of avian pancreatic polypeptide. small globular protein hormone

SCOP Domain Sequences for d1ppt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppt__ j.6.1.1 (-) Pancreatic polypeptide {Turkey (Meleagris gallopavo)}
gpsqptypgddapvedlirfydnlqqylnvvtrhry

SCOP Domain Coordinates for d1ppt__:

Click to download the PDB-style file with coordinates for d1ppt__.
(The format of our PDB-style files is described here.)

Timeline for d1ppt__: