PDB entry 1ppt

View 1ppt on RCSB PDB site
Description: x-ray analysis (1.4-angstroms resolution) of avian pancreatic polypeptide. small globular protein hormone
Deposited on 1981-01-16, released 1981-02-19
The last revision prior to the SCOP 1.61 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1ppt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppt_ (-)
    gpsqptypgddapvedlirfydnlqqylnvvtrhry